Sequence (fasta): 6n3pDownload

>6N3PA:3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
SNAMTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG
KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF
EKTRRGLTRFKGVALVDGKVVCEATMMCARSREA
>6N3PB:3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
SNAMTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG
KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF
EKTRRGLTRFKGVALVDGKVVCEATMMCARSREA
>6N3PC:3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
SNAMTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG
KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF
EKTRRGLTRFKGVALVDGKVVCEATMMCARSREA
>6N3PD:3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
SNAMTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG
KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF
EKTRRGLTRFKGVALVDGKVVCEATMMCARSREA
>6N3PE:3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
SNAMTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG
KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF
EKTRRGLTRFKGVALVDGKVVCEATMMCARSREA
>6N3PF:3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
SNAMTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPG
KPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTF
EKTRRGLTRFKGVALVDGKVVCEATMMCARSREA
>6N3PG:Acyl carrier protein
SNASTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDE
EAEKITTVQAAIDYINGHQA
>6N3PH:Acyl carrier protein
SNASTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDE
EAEKITTVQAAIDYINGHQA
>6N3PI:Acyl carrier protein
SNASTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDE
EAEKITTVQAAIDYINGHQA
>6N3PJ:Acyl carrier protein
SNASTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDE
EAEKITTVQAAIDYINGHQA
>6N3PK:Acyl carrier protein
SNASTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDE
EAEKITTVQAAIDYINGHQA
>6N3PL:Acyl carrier protein
SNASTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDE
EAEKITTVQAAIDYINGHQA