Sequence (fasta): 6k18Download

>6K18A:Exonuclease 3'-5' domain-containing protein 2
KAKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWVNLEGKASPLSLLQMASPSGLCVL
VRLPKLICGGKTLPRTLLDILADGTILKVGVGCSEDASKLLQDYGLVVRGCLDLRYLAMR
QRNNLLCNGLSLKSLAETVLNFPLDKSLLLRCSNWDAETLTEDQVIYAARDAQISVALFL
HLLGYPFSRNSPGEKNDDHSSWRKVLEKCQGVVDIPFRSK
>6K18B:Exonuclease 3'-5' domain-containing protein 2
KAKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWVNLEGKASPLSLLQMASPSGLCVL
VRLPKLICGGKTLPRTLLDILADGTILKVGVGCSEDASKLLQDYGLVVRGCLDLRYLAMR
QRNNLLCNGLSLKSLAETVLNFPLDKSLLLRCSNWDAETLTEDQVIYAARDAQISVALFL
HLLGYPFSRNSPGEKNDDHSSWRKVLEKCQGVVDIPFRSK