Sequence (fasta): 6jkwDownload

>6JKWA:Metallo-beta-lactamases PNGM-1
AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGMPTARRAQAAAAWVVELGNGDK
FIVDIGSGSMANIQSLMIPANYLTKIFLTHLHTDHWGDLVSMWAGGWTAGRTDPLEVWGP
SGSREDMGTKYAVEHMLKAYNWDYMTRAVTINPRPGDINVHEFDYRALNEVVYQENGVTF
RSWPCIHAGDGPVSFALEWNGYKVVFGGDTAPNIWYPEYAKGADLAIHECWMTSDQMMTK
YNQPAQLALRINLDFHTSAQSFGQIMNMVQPRHAVAYHFFNDDDTRYDIYTGVRENYAGP
LSMATDMMVWNITRDAVTERMAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFMG
>6JKWB:Metallo-beta-lactamases PNGM-1
AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGMPTARRAQAAAAWVVELGNGDK
FIVDIGSGSMANIQSLMIPANYLTKIFLTHLHTDHWGDLVSMWAGGWTAGRTDPLEVWGP
SGSREDMGTKYAVEHMLKAYNWDYMTRAVTINPRPGDINVHEFDYRALNEVVYQENGVTF
RSWPCIHAGDGPVSFALEWNGYKVVFGGDTAPNIWYPEYAKGADLAIHECWMTSDQMMTK
YNQPAQLALRINLDFHTSAQSFGQIMNMVQPRHAVAYHFFNDDDTRYDIYTGVRENYAGP
LSMATDMMVWNITRDAVTERMAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFMG
>6JKWC:Metallo-beta-lactamases PNGM-1
AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGMPTARRAQAAAAWVVELGNGDK
FIVDIGSGSMANIQSLMIPANYLTKIFLTHLHTDHWGDLVSMWAGGWTAGRTDPLEVWGP
SGSREDMGTKYAVEHMLKAYNWDYMTRAVTINPRPGDINVHEFDYRALNEVVYQENGVTF
RSWPCIHAGDGPVSFALEWNGYKVVFGGDTAPNIWYPEYAKGADLAIHECWMTSDQMMTK
YNQPAQLALRINLDFHTSAQSFGQIMNMVQPRHAVAYHFFNDDDTRYDIYTGVRENYAGP
LSMATDMMVWNITRDAVTERMAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFMG
>6JKWD:Metallo-beta-lactamases PNGM-1
AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGMPTARRAQAAAAWVVELGNGDK
FIVDIGSGSMANIQSLMIPANYLTKIFLTHLHTDHWGDLVSMWAGGWTAGRTDPLEVWGP
SGSREDMGTKYAVEHMLKAYNWDYMTRAVTINPRPGDINVHEFDYRALNEVVYQENGVTF
RSWPCIHAGDGPVSFALEWNGYKVVFGGDTAPNIWYPEYAKGADLAIHECWMTSDQMMTK
YNQPAQLALRINLDFHTSAQSFGQIMNMVQPRHAVAYHFFNDDDTRYDIYTGVRENYAGP
LSMATDMMVWNITRDAVTERMAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFMG
>6JKWE:Metallo-beta-lactamases PNGM-1
AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGMPTARRAQAAAAWVVELGNGDK
FIVDIGSGSMANIQSLMIPANYLTKIFLTHLHTDHWGDLVSMWAGGWTAGRTDPLEVWGP
SGSREDMGTKYAVEHMLKAYNWDYMTRAVTINPRPGDINVHEFDYRALNEVVYQENGVTF
RSWPCIHAGDGPVSFALEWNGYKVVFGGDTAPNIWYPEYAKGADLAIHECWMTSDQMMTK
YNQPAQLALRINLDFHTSAQSFGQIMNMVQPRHAVAYHFFNDDDTRYDIYTGVRENYAGP
LSMATDMMVWNITRDAVTERMAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFMG
>6JKWF:Metallo-beta-lactamases PNGM-1
AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGMPTARRAQAAAAWVVELGNGDK
FIVDIGSGSMANIQSLMIPANYLTKIFLTHLHTDHWGDLVSMWAGGWTAGRTDPLEVWGP
SGSREDMGTKYAVEHMLKAYNWDYMTRAVTINPRPGDINVHEFDYRALNEVVYQENGVTF
RSWPCIHAGDGPVSFALEWNGYKVVFGGDTAPNIWYPEYAKGADLAIHECWMTSDQMMTK
YNQPAQLALRINLDFHTSAQSFGQIMNMVQPRHAVAYHFFNDDDTRYDIYTGVRENYAGP
LSMATDMMVWNITRDAVTERMAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFMG
>6JKWG:Metallo-beta-lactamases PNGM-1
AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGMPTARRAQAAAAWVVELGNGDK
FIVDIGSGSMANIQSLMIPANYLTKIFLTHLHTDHWGDLVSMWAGGWTAGRTDPLEVWGP
SGSREDMGTKYAVEHMLKAYNWDYMTRAVTINPRPGDINVHEFDYRALNEVVYQENGVTF
RSWPCIHAGDGPVSFALEWNGYKVVFGGDTAPNIWYPEYAKGADLAIHECWMTSDQMMTK
YNQPAQLALRINLDFHTSAQSFGQIMNMVQPRHAVAYHFFNDDDTRYDIYTGVRENYAGP
LSMATDMMVWNITRDAVTERMAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFMG
>6JKWH:Metallo-beta-lactamases PNGM-1
AGGKVTSSTGIAPKRYVYYPGSEELGPDEIRVIACGTGMPTARRAQAAAAWVVELGNGDK
FIVDIGSGSMANIQSLMIPANYLTKIFLTHLHTDHWGDLVSMWAGGWTAGRTDPLEVWGP
SGSREDMGTKYAVEHMLKAYNWDYMTRAVTINPRPGDINVHEFDYRALNEVVYQENGVTF
RSWPCIHAGDGPVSFALEWNGYKVVFGGDTAPNIWYPEYAKGADLAIHECWMTSDQMMTK
YNQPAQLALRINLDFHTSAQSFGQIMNMVQPRHAVAYHFFNDDDTRYDIYTGVRENYAGP
LSMATDMMVWNITRDAVTERMAVSPDHAWDVAGPSEDLAPDRNRASEYTQYILDGRLNVD
EANAHWKQEFMG