Sequence (fasta): 6intDownload

>6INTA:Xylose isomerase
MGYFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLRFGVAYWHSFTGNGSDPFG
AGTALRGWNELSGMELAKARVEACFELLNILDVDYFCFHDRDIAPEGDTLQETNRNLDEI
VALIKQHMHSSGKKLLWNTANMFTNPRFVHGAATTSNADVFAYAAAQVKKALDHGKELGA
ENYVFWGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDAQFLIEPKPKEPSKHQ
YDFDAATTLQFLQKYDLAKHFKLNLEANHATLAGHTFEHELRVARINGALGSIDANQGDL
LLGWDTDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTSFEPIDVVYAHINGMD
AFARGLQVAAKLIEDRAFDNVIEERYASFTKGIGADIVSGKANFHTLEAYALQNNPITNK
SGRVELLRSILNQYIINV
>6INTB:Xylose isomerase
MGYFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLRFGVAYWHSFTGNGSDPFG
AGTALRGWNELSGMELAKARVEACFELLNILDVDYFCFHDRDIAPEGDTLQETNRNLDEI
VALIKQHMHSSGKKLLWNTANMFTNPRFVHGAATTSNADVFAYAAAQVKKALDHGKELGA
ENYVFWGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDAQFLIEPKPKEPSKHQ
YDFDAATTLQFLQKYDLAKHFKLNLEANHATLAGHTFEHELRVARINGALGSIDANQGDL
LLGWDTDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTSFEPIDVVYAHINGMD
AFARGLQVAAKLIEDRAFDNVIEERYASFTKGIGADIVSGKANFHTLEAYALQNNPITNK
SGRVELLRSILNQYIINV
>6INTC:Xylose isomerase
MGYFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLRFGVAYWHSFTGNGSDPFG
AGTALRGWNELSGMELAKARVEACFELLNILDVDYFCFHDRDIAPEGDTLQETNRNLDEI
VALIKQHMHSSGKKLLWNTANMFTNPRFVHGAATTSNADVFAYAAAQVKKALDHGKELGA
ENYVFWGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDAQFLIEPKPKEPSKHQ
YDFDAATTLQFLQKYDLAKHFKLNLEANHATLAGHTFEHELRVARINGALGSIDANQGDL
LLGWDTDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTSFEPIDVVYAHINGMD
AFARGLQVAAKLIEDRAFDNVIEERYASFTKGIGADIVSGKANFHTLEAYALQNNPITNK
SGRVELLRSILNQYIINV
>6INTD:Xylose isomerase
MGYFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLRFGVAYWHSFTGNGSDPFG
AGTALRGWNELSGMELAKARVEACFELLNILDVDYFCFHDRDIAPEGDTLQETNRNLDEI
VALIKQHMHSSGKKLLWNTANMFTNPRFVHGAATTSNADVFAYAAAQVKKALDHGKELGA
ENYVFWGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDAQFLIEPKPKEPSKHQ
YDFDAATTLQFLQKYDLAKHFKLNLEANHATLAGHTFEHELRVARINGALGSIDANQGDL
LLGWDTDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTSFEPIDVVYAHINGMD
AFARGLQVAAKLIEDRAFDNVIEERYASFTKGIGADIVSGKANFHTLEAYALQNNPITNK
SGRVELLRSILNQYIINV
>6INTE:Xylose isomerase
MGYFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLRFGVAYWHSFTGNGSDPFG
AGTALRGWNELSGMELAKARVEACFELLNILDVDYFCFHDRDIAPEGDTLQETNRNLDEI
VALIKQHMHSSGKKLLWNTANMFTNPRFVHGAATTSNADVFAYAAAQVKKALDHGKELGA
ENYVFWGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDAQFLIEPKPKEPSKHQ
YDFDAATTLQFLQKYDLAKHFKLNLEANHATLAGHTFEHELRVARINGALGSIDANQGDL
LLGWDTDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTSFEPIDVVYAHINGMD
AFARGLQVAAKLIEDRAFDNVIEERYASFTKGIGADIVSGKANFHTLEAYALQNNPITNK
SGRVELLRSILNQYIINV
>6INTF:Xylose isomerase
MGYFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLRFGVAYWHSFTGNGSDPFG
AGTALRGWNELSGMELAKARVEACFELLNILDVDYFCFHDRDIAPEGDTLQETNRNLDEI
VALIKQHMHSSGKKLLWNTANMFTNPRFVHGAATTSNADVFAYAAAQVKKALDHGKELGA
ENYVFWGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDAQFLIEPKPKEPSKHQ
YDFDAATTLQFLQKYDLAKHFKLNLEANHATLAGHTFEHELRVARINGALGSIDANQGDL
LLGWDTDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTSFEPIDVVYAHINGMD
AFARGLQVAAKLIEDRAFDNVIEERYASFTKGIGADIVSGKANFHTLEAYALQNNPITNK
SGRVELLRSILNQYIINV
>6INTG:Xylose isomerase
MGYFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLRFGVAYWHSFTGNGSDPFG
AGTALRGWNELSGMELAKARVEACFELLNILDVDYFCFHDRDIAPEGDTLQETNRNLDEI
VALIKQHMHSSGKKLLWNTANMFTNPRFVHGAATTSNADVFAYAAAQVKKALDHGKELGA
ENYVFWGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDAQFLIEPKPKEPSKHQ
YDFDAATTLQFLQKYDLAKHFKLNLEANHATLAGHTFEHELRVARINGALGSIDANQGDL
LLGWDTDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTSFEPIDVVYAHINGMD
AFARGLQVAAKLIEDRAFDNVIEERYASFTKGIGADIVSGKANFHTLEAYALQNNPITNK
SGRVELLRSILNQYIINV
>6INTH:Xylose isomerase
MGYFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLRFGVAYWHSFTGNGSDPFG
AGTALRGWNELSGMELAKARVEACFELLNILDVDYFCFHDRDIAPEGDTLQETNRNLDEI
VALIKQHMHSSGKKLLWNTANMFTNPRFVHGAATTSNADVFAYAAAQVKKALDHGKELGA
ENYVFWGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDAQFLIEPKPKEPSKHQ
YDFDAATTLQFLQKYDLAKHFKLNLEANHATLAGHTFEHELRVARINGALGSIDANQGDL
LLGWDTDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTSFEPIDVVYAHINGMD
AFARGLQVAAKLIEDRAFDNVIEERYASFTKGIGADIVSGKANFHTLEAYALQNNPITNK
SGRVELLRSILNQYIINV