Sequence (fasta): 6inbDownload

>6INBA:Alpha-acetolactate decarboxylase
MNHSAECTCEESLCETLRAFSAQHPESVLYQTSLMSALLSGVYEGSTTIADLLKHGDFGL
GTFNELDGELIAFSSQVYQLRADGSARNAQPEQKTPFAVMTWFQPQYRKTFDHPVSRQQL
HEVIDQQIPSDNLFCALRIDGHFRHAHTRTVPRQTPPYRAMTDVLDDQPVFRFNQREGVL
VGFRTPQHMQGINVAGYHEHFITDDRKGGGHLLDYQLDHGVLTFGEIHKLMIDLPADSAF
LQANLHPDNLDAAIRSVES