Sequence (fasta): 6h8kDownload

>6H8K1:NADH-ubiquinone oxidoreductase chain 1
MIINIVEILIFLVCVLFSVAYLTVAERKTLAYMQRRLGPNFVGYYGLLQAFADAVKLLLK
EIVLPKESNYIILVISPLITLITALIGWVVIPLGPGITLGELNLGILFSLAIGSLGVFGS
LLSGWSSNSKYSLLGSIRSTAQLISYELILTSIFIIIIMFVSSLNITTIIETQRVVWYCI
PLLPLLLIFFIASVAETARPPFDLTESESELVAGYFTEYSGSPFVFFFLAEYSNIILISA
FNGYLLLGGYLSFNYSYLFNILFNDYSYVSFLFEGLINSSAYAIKLVFLMFSFIWVRAAF
PRFTYDNLINFCWIILLPLLFGIFLIIPSTLYIFD
>6H8KE:NUEM protein
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXX
>6H8KG:NUGM protein
SDLHQYAKYIMAALPKYIQGFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXTPVPSITCLYEGANWFEREAYDMYGVFFEGHPDL
RRIMTDYGFEGHP
>6H8KH:Subunit NUHM of NADH:Ubiquinone Oxidoreductase (Complex I)
XXXXXXXXXXXXXXXXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXCTTTPCQLCGSDGIMEAVQXXXGXGXGXXXXXGXXXXXXCXGXCXXXXXXXXXXXX
XXXXXXXXXGXXXGXXXXXXXXXGXXXXXXXXXX
>6H8KI:Subunit NUIM of NADH:Ubiquinone Oxidoreductase (Complex I)
SKATKYFLLAEMFRGLYVVLEXXXXXXXXXXXXXXXXXXERCIACKLCEAICPALAITID
AEERIDGSRRTTKYDIDMTKCIYCGYCQESCPVDAIVETPNVEYATETXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXX
>6H8KK:Subunit NUKM of protein NADH:Ubiquinone Oxidoreductase (Complex I)
YTLTTLDAVANWARQGSFWPVTFGLACCAVEMMHVSAPRYDQDRLGIIFRASPRQSDIMI
VAGTLTNKMAPVLRCVYDQMPEPRWVISMGSCANGGGYYHFSYSVVRGCDRIVPVDVYVP
GCPPTSEALMYGVFQLQRKMRNTKITR
>6H8KL:NADH-ubiquinone oxidoreductase chain 4L
MFIGTIILVLSFLGFVFNRRNIILAFICLETMLLGINLILLRNSVLFDDISGSLFAIVII
ILAGVESAIGLSLLVSYYR
>6H8KZ:Unknown polypeptide
XXXXXXXXXXXXXXXXX
>6H8Kr:Unknown polypeptide
XXXXXXXXXXXXXXXXX
>6H8KY:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8KAF:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8KU:Unknown polypeptide
XXXXXXXXXX
>6H8KX:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8K2:NADH-ubiquinone oxidoreductase chain 2,NADH dehydrogenase subunit 2
MLILAIISLITFVSMSKLSDNRAIIRLINIYLILVLVLDSFLYLLFLNNQTYTVMGELLI
FNSFTFYIDMLIYFIMIVISSLYGXXXXXXXXXXXXXXXXXXXXXXXSNDFITLFVAIEL
QSYSIYLITAIYNSSYKASKASMLYFFMGGILSILIAYSINTYYSVLNSYTLHSLDSLII
NTLDLNLILIALSLGLLFKIGIAPLHKWLISIYENTPILITIYISLIPKISILSYLVLXX
XXXXSILAILTLLVGSVGGLLQIKIKRLLAFSGLTNAGYMMLLLLLNNNEFSYLYYITQY
SISHLAIFMIIIXXXXXXXXXXXXXXXXXXXXXXXXXLVLSMAIVVFSFIGIPPLLGFFG
KLNILMSILNNGYYFISIVLIVASLISALYYLYXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXX
>6H8KW:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8KV:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXX
>6H8KT:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXX
>6H8Km:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXX
>6H8KAI:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXX
>6H8KS:Unknown polypeptide
XXXXXXXXXXXXXXXXXXX
>6H8KAJ:Unknown polypeptide
XXXXXXXXXXXXXXXXXXX
>6H8KAL:Unknown polypeptide
XXXXXXXXXXXXXXXXXXX
>6H8KR:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8KQ:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXX
>6H8KP:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8KF:Unknown polypeptide
XXXXXXXXXXXXXXXXXX
>6H8Kf:Unknown polypeptide
XXXXXXXXXXXXXXXXXX
>6H8KAC:Unknown polypeptide
XXXXXXXXXXXXXXXXXX
>6H8KAH:Unknown polypeptide
XXXXXXXXXXXXXXXXXX
>6H8KAM:Unknown polypeptide
XXXXXXXXXXXXXXXXXX
>6H8KO:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXX
>6H8Kl:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXX
>6H8KM:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8K3:NADH-ubiquinone oxidoreductase chain 3
MNTFIIFIILIPIVGFALLAVNILLAVYKPYNEKLGAFECGLTSFNQTRLAFNAAFILVA
ILFLPFDLEISTLLPYVMSIYLVSNYGFTIVLLFLLILIIGFVYEINTNA
>6H8KD:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8KJ:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXX
>6H8KN:Unknown polypeptide
XXXXXXXXXXXXXXX
>6H8Ka:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8Ki:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8Kb:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXX
>6H8Kc:Unknown polypeptide
XXXXXXXXX
>6H8Kg:Unknown polypeptide
XXXXXXXXX
>6H8KAE:Unknown polypeptide
XXXXXXXXX
>6H8KAK:Unknown polypeptide
XXXXXXXXX
>6H8KAO:Unknown polypeptide
XXXXXXXXX
>6H8Kd:Unknown polypeptide
XXXXXXXXXXXXXXXX
>6H8Ko:Unknown polypeptide
XXXXXXXXXXXXXXXX
>6H8KAB:Unknown polypeptide
XXXXXXXXXXXXXXXX
>6H8KAN:Unknown polypeptide
XXXXXXXXXXXXXXXX
>6H8Ke:Unknown polypeptide
XXXXXXXXXXXXX
>6H8Kw:Unknown polypeptide
XXXXXXXXXXXXX
>6H8Kz:Unknown polypeptide
XXXXXXXXXXXXX
>6H8Kh:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8Kj:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8K4:NADH-ubiquinone oxidoreductase chain 4
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
SFYILFEATLPLLFILIHIYGSSDSERASFYVLMFTLSGSLFMLLSIVVISIVLNTTNFI
NHNLFVLSLDLQTIIWLGLFIAIMVKTPLFPIHVWLPVVHSESPLAGSMILAGLILKLAL
YAILRLLLPLLCEAQILYTPMIYIISLLTIILTSLATLRQIDLKVIIAYSSISHMGIAIL
GVCSNTSLGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYKGLTTYMPQLATY
IIILSFANIGTPLTGNFTGEFLSLQGGFIRNPIXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXFIMNILIISTLIIGICPQIMXXXXXXXXXXXXXXX
>6H8Kk:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXX
>6H8Ks:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXX
>6H8Kn:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8Kq:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8Kp:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXX
>6H8Kt:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8Ku:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8Kv:Unknown polypeptide
XXXXXXXXXXX
>6H8Ky:Unknown polypeptide
XXXXXXXXXXX
>6H8Kx:Unknown polypeptide
XXXXXXXX
>6H8KAG:Unknown polypeptide
XXXXXXXX
>6H8KAA:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8KAD:Unknown polypeptide
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8K5:NADH-ubiquinone oxidoreductase chain 5
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLDINYNFEIDALTITMLLAITTISSMVHIYSIGYMETDPHQVRFFSLLSM
FTFWMIILVTGSNYFVLFVGWEFIGVTSYLLISFWVTRLQAMKSALSAVLMNRFGDAFFV
LGLCVIAYVFGXXXXXXXXXXXXXTDLLVLIMLALFIAAMAKSAQFGLHNWLTLAMEGPT
PVSSLLHAATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRIIAL
STMSQLGMMTIAIGLSAXXLALFHLLGHAFFKALLFMSAGSIIHSILXXXXXXXXXXXXX
XXLPYTYICITIASLSLMAMPGLTGYYTKDIIIESTYGSXXXXXXXAYLSAVLTCVYSMK
ILYLTFXXXXXXXXXXXXXXTLPMFILAIFAMFAGWXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
GLVTSGNIAHHVDKGSLYRLGPVGIXXXXXXXXXXXXMNSMLILITIVSLLLLVLVMNVN
FIIVIPVLISILYILX
>6H8K6:NADH-ubiquinone oxidoreductase chain 6
XXXXXXXXXITIFLAILCTIFIISAKNPMVSILYMIALFVIAAMYLYLIGLGIFSLLYIM
IYIGAIAVLFLFIITLLDINSTELSVKSNIRDLPLVLISLIVLTISGLMIYSNDSILINK
LLEAFGNDYNTIITQDWFNIENTTLLTTIGNVLLTNNAFILLVLAIVLLLGIIGPISITM
KHKE
>6H8KA:NUAM protein
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCYHDKLAIAGNCRMCLVDVERAPKPVA
SCAYPVAPGMVVRTDTERVKQARENVMEMMLQNHPLDCPVCDQGGECDLQDQSXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXCIHCTRCVRFANDIAGAXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
>6H8KB:NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPSGLKWSFMNPPGW
EKNXXXXXXDREIMRKDPHKLVEGCLLAGRAMNATAAYIYXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGQCTPCREGT
TWLLKAMDRFRTGQAKEREIDMLYELTKDIEGHTICALGDAAAXXXXXXXXXXXXXXXXX
XXXXXXXXXX
>6H8KC:NUCM protein
FTINFGPQHPAAHGVLRLILELSGEEIIRSDPHVGLLHRGTEKLIEYKTYMQALPYFDRL
DYVSMMTNEQVFSLAVEKLLNVEVPLRGKYIRTMFGEITRVLNHLMSVCSHAMDVGALTP
FLWGFEEREKLMEFYERVSGARLHAAYVRPGGVSQDLPAGLLDDIYMWATQFGDRLDEIE
ELLTDNRIWKLRTVNIGTVTAQDALNLGLSGPMLRGSGIPFDIRKNAPYDAYDKVDFDVP
VGMNGDCYDRYLIRMAEFRQSLRIIEQCCNDMPAGAVKVEDFKINSPPRNLMKEDMEALI
HHFLLYTKGYSVPPGETYTAIEAPKGEMGVYVVSDGSERPYKCKIRAPGFAHLGAFDHIA
RGHFLPDAVAIIGTMDLVFGEVD