Sequence (fasta): 6gg7Download

>6GG7B:Glyceraldehyde-3-phosphate dehydrogenase
GSMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQD
AEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAK
KVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMT
TTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPT
PNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDA
SLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
>6GG7A:Glyceraldehyde-3-phosphate dehydrogenase
GSMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQD
AEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAK
KVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMT
TTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPT
PNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDA
SLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
>6GG7C:CP12 polypeptide
GSMSNLEKQIEQAREEAHKICDTEGATSGQCAAAWDALEELQAEAAHQRAEQQDHKTSFQ
QYCDDNPDAAECRIYDD
>6GG7D:CP12 polypeptide
GSMSNLEKQIEQAREEAHKICDTEGATSGQCAAAWDALEELQAEAAHQRAEQQDHKTSFQ
QYCDDNPDAAECRIYDD