Sequence (fasta): 6gfoDownload

>6GFOA:Glyceraldehyde-3-phosphate dehydrogenase
GSMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQD
AEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAK
KVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMT
TTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPT
PNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDA
SLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
>6GFOB:Glyceraldehyde-3-phosphate dehydrogenase
GSMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQD
AEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAK
KVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMT
TTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPT
PNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDA
SLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
>6GFOC:Glyceraldehyde-3-phosphate dehydrogenase
GSMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQD
AEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAK
KVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMT
TTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPT
PNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDA
SLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
>6GFOD:Glyceraldehyde-3-phosphate dehydrogenase
GSMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQD
AEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAK
KVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMT
TTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPT
PNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDA
SLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
>6GFOE:CP12 polypeptide
GSMSNLEKQIEQAREEAHKICDTEGATSGQCAAAWDALEELQAEAAHQRAEQQDHKTSFQ
QYCDDNPDAAECRIYDD
>6GFOF:CP12 polypeptide
GSMSNLEKQIEQAREEAHKICDTEGATSGQCAAAWDALEELQAEAAHQRAEQQDHKTSFQ
QYCDDNPDAAECRIYDD