Sequence (fasta): 6g6sDownload

>6G6SA:Apoptotic chromatin condensation inducer in the nucleus
GSGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVAT
RTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLV
>6G6SB:Apoptotic chromatin condensation inducer in the nucleus
GSGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVAT
RTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLV