Sequence (fasta): 6g5kDownload

>6G5KA:Botulinum neurotoxin type B
MGSSHHHHHHSSGLVPRGSHMASMNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVE
LNDKNQFKLTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTI
INCMKNNSGWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLN
NAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIE
ERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSK
YINYRDLYIGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEK
LFLAPISDSDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEE
YKDYFCISKWYLKEVKRKPYNLKLGCNWQFIPKDEGWTELQ
>6G5KB:Botulinum neurotoxin type B
MGSSHHHHHHSSGLVPRGSHMASMNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVE
LNDKNQFKLTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTI
INCMKNNSGWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLN
NAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIE
ERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSK
YINYRDLYIGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEK
LFLAPISDSDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEE
YKDYFCISKWYLKEVKRKPYNLKLGCNWQFIPKDEGWTELQ
>6G5KC:Synaptotagmin-1
GEGKEDAFSKLKEKFMNELHK
>6G5KD:Synaptotagmin-1
GEGKEDAFSKLKEKFMNELHK