Sequence (fasta): 6g59Download

>6G59A:Alanine racemase 1
MASWSHPQFEKGAVTSLYKKAGFSDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVV
KANAYGLGSVKVARHLMENGATFFAVATLDEAIELRMHGITAKILVLGVLPAKDIDKAIQ
HRVALTVPSKQWLKEAIKNISGEQEKKLWLHIKLDTGMGRLGIKDTNTYQEVIEIIQQYE
QLVFEGVFTHFACADEPGDMTTEQYQRFKDMVNEAIKPEYIHCQNSAGSLLMDCQFCNAI
RPGISLYGYYPSEYVQQKVKVHLKPSVQLIANVVQTKTLQAGESVSYGATYTATDPTTIA
LLPIGYADGYLRIMQGSFVNVNGHQCEVIGRVCMDQTIVKVPDQVKAGDSVILIDNHRES
PQSVEVVAEKQHTINYEVLCNLSRRLPRIYHDGDQRFVTNELLK
>6G59B:Alanine racemase 1
MASWSHPQFEKGAVTSLYKKAGFSDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVV
KANAYGLGSVKVARHLMENGATFFAVATLDEAIELRMHGITAKILVLGVLPAKDIDKAIQ
HRVALTVPSKQWLKEAIKNISGEQEKKLWLHIKLDTGMGRLGIKDTNTYQEVIEIIQQYE
QLVFEGVFTHFACADEPGDMTTEQYQRFKDMVNEAIKPEYIHCQNSAGSLLMDCQFCNAI
RPGISLYGYYPSEYVQQKVKVHLKPSVQLIANVVQTKTLQAGESVSYGATYTATDPTTIA
LLPIGYADGYLRIMQGSFVNVNGHQCEVIGRVCMDQTIVKVPDQVKAGDSVILIDNHRES
PQSVEVVAEKQHTINYEVLCNLSRRLPRIYHDGDQRFVTNELLK