Sequence (fasta): 6g56Download

>6G56A:Alanine racemase 1
MASWSHPQFEKGAVTSLYKKAGFSDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVV
KANAYGLGSVKVARHLMENGATFFAVATLDEAIELRMHGITAKILVLGVLPAKDIDKAIQ
HRVALTVPSKQWLKEAIKNISGEQEKKLWLHIKLDTGMGRLGIKDTNTYQEVIEIIQQYE
QLVFEGVFTHFACADEPGDMTTEQYQRFKDMVNEAIKPEYIHCQNSAGSLLMDCQFCNAI
RPGISLYGYYPSEYVQQKVKVHLKPSVQLIANVVQTKTLQAGESVSYGATYTATDPTTIA
LLPIGYADGYLRIMQGSFVNVNGHQCEVIGRVCMDQTIVKVPDQVKAGDSVILIDNHRES
PQSVEVVAEKQHTINYEVLCNLSRRLPRIYHDGDQRFVTNELLK
>6G56B:Alanine racemase 1
MASWSHPQFEKGAVTSLYKKAGFSDKYYRSAYMNVDLNAVASNFKVFSTLHPNKTVMAVV
KANAYGLGSVKVARHLMENGATFFAVATLDEAIELRMHGITAKILVLGVLPAKDIDKAIQ
HRVALTVPSKQWLKEAIKNISGEQEKKLWLHIKLDTGMGRLGIKDTNTYQEVIEIIQQYE
QLVFEGVFTHFACADEPGDMTTEQYQRFKDMVNEAIKPEYIHCQNSAGSLLMDCQFCNAI
RPGISLYGYYPSEYVQQKVKVHLKPSVQLIANVVQTKTLQAGESVSYGATYTATDPTTIA
LLPIGYADGYLRIMQGSFVNVNGHQCEVIGRVCMDQTIVKVPDQVKAGDSVILIDNHRES
PQSVEVVAEKQHTINYEVLCNLSRRLPRIYHDGDQRFVTNELLK