Sequence (fasta): 6fptDownload

>6FPTA:E3 ubiquitin-protein ligase TRIM71
MAHHHHHHSSGLEVLFQGPSSGAFATASKAHGEGIKRALQGKPASFTVVGYDHDGEPRLS
GGDSVSVVLMSPDGNLSSAEVSDHQDGTYTVSYLPKGEGEHLLSVLICNQHIEGSPFKVM
VKSGRSYGGVGLPMASFGGEGDGDGQLCRPWGICVDKEGYVVVADRSNNRVQIFKPCGTF
HHKFGTLGSRPGQFDRPAGVACDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQ
FNYPWDVAVNFEGKILVSDTRNHRVQLFGPDGTFLNKYGFEGALWKHFDSPRGVAFNQEG
HLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVAVDQEDRIIVADSRNHRIQ
VFEPNGNFLCKFGTHGNGFGQMDRPSGIAVTPDGVIVAVDFGNNRILMF
>6FPTB:E3 ubiquitin-protein ligase TRIM71
MAHHHHHHSSGLEVLFQGPSSGAFATASKAHGEGIKRALQGKPASFTVVGYDHDGEPRLS
GGDSVSVVLMSPDGNLSSAEVSDHQDGTYTVSYLPKGEGEHLLSVLICNQHIEGSPFKVM
VKSGRSYGGVGLPMASFGGEGDGDGQLCRPWGICVDKEGYVVVADRSNNRVQIFKPCGTF
HHKFGTLGSRPGQFDRPAGVACDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQ
FNYPWDVAVNFEGKILVSDTRNHRVQLFGPDGTFLNKYGFEGALWKHFDSPRGVAFNQEG
HLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVAVDQEDRIIVADSRNHRIQ
VFEPNGNFLCKFGTHGNGFGQMDRPSGIAVTPDGVIVAVDFGNNRILMF