Sequence (fasta): 6eerDownload

>6EERA:GoxA
MSNCQYKIYPPLGIARVGNGPAIKPLSLSTPEVPWAHLYDTNVQYLVTQQELEQLLEEAF
GGNVINEISQIKTKLDERKAEKFKQEEIETITGLLGLSHLVPQQQLSRSLDNLELKSTKD
SDDIVQQIKGALLKVLSDHYLHAVKKQAQNFYIYKCDEQGNPVEKLKLTDGDKVTWRVEV
ANKKSFWYDYNNALDLSLHTQGSGNLSKNVSKHRLAPAMTAKRRNPNVITNSLRKQLVIS
SQGSVSSDNNTQVPLRGKFPANEPDTNNRLSDLLNLQERHNVLQGSIECDNEGVLRFYAG
NGISQALSPSSLNTDFADNSNWFDDICDGRVTAVVELKNGDTFEIQDEQSSAWVATTPPD
YAPQIEPIVTMYDMVSGAALKEQDLDNLTTQFSDVFPILYRLYRMQWVNQADFTDNAVNT
QIRELNSELGFAQLLDNSASAKSLREGIFNQFRNPLFDQDIDVDDPGQSSNEWVSNSRII
PSKDETNIAAKPATSSLKLPFYPNDGIDYPGSPVQWFAIPPFMYQHLQNWAAGDFSVTQV
EKESANTIEELGLFYSEQFKNSPNSALLCARGALDALYGGGFHPGVELTWPMRHNLIYSQ
NDYVSSVTPEINLLGLREFRLKQDLQGLNSPNMYQDFGHVIAVDNVTASIDPNSDAAWLW
RSTPGDLTKWMGIPWQSDAASCQAVYTPEDFPIPSWXAANLPVHVLPLARYNKFKDSQSA
DLPEINGMTHSIAQGMSEETFEHLRLEQFSQRLDWLHTADLGFVGYHAEGGYTNGLIQMV
SQWKNMAMVMARPVENPGSSGIPNVVYVAYSQADKD
>6EERB:GoxA
MSNCQYKIYPPLGIARVGNGPAIKPLSLSTPEVPWAHLYDTNVQYLVTQQELEQLLEEAF
GGNVINEISQIKTKLDERKAEKFKQEEIETITGLLGLSHLVPQQQLSRSLDNLELKSTKD
SDDIVQQIKGALLKVLSDHYLHAVKKQAQNFYIYKCDEQGNPVEKLKLTDGDKVTWRVEV
ANKKSFWYDYNNALDLSLHTQGSGNLSKNVSKHRLAPAMTAKRRNPNVITNSLRKQLVIS
SQGSVSSDNNTQVPLRGKFPANEPDTNNRLSDLLNLQERHNVLQGSIECDNEGVLRFYAG
NGISQALSPSSLNTDFADNSNWFDDICDGRVTAVVELKNGDTFEIQDEQSSAWVATTPPD
YAPQIEPIVTMYDMVSGAALKEQDLDNLTTQFSDVFPILYRLYRMQWVNQADFTDNAVNT
QIRELNSELGFAQLLDNSASAKSLREGIFNQFRNPLFDQDIDVDDPGQSSNEWVSNSRII
PSKDETNIAAKPATSSLKLPFYPNDGIDYPGSPVQWFAIPPFMYQHLQNWAAGDFSVTQV
EKESANTIEELGLFYSEQFKNSPNSALLCARGALDALYGGGFHPGVELTWPMRHNLIYSQ
NDYVSSVTPEINLLGLREFRLKQDLQGLNSPNMYQDFGHVIAVDNVTASIDPNSDAAWLW
RSTPGDLTKWMGIPWQSDAASCQAVYTPEDFPIPSWXAANLPVHVLPLARYNKFKDSQSA
DLPEINGMTHSIAQGMSEETFEHLRLEQFSQRLDWLHTADLGFVGYHAEGGYTNGLIQMV
SQWKNMAMVMARPVENPGSSGIPNVVYVAYSQADKD
>6EERC:GoxA
MSNCQYKIYPPLGIARVGNGPAIKPLSLSTPEVPWAHLYDTNVQYLVTQQELEQLLEEAF
GGNVINEISQIKTKLDERKAEKFKQEEIETITGLLGLSHLVPQQQLSRSLDNLELKSTKD
SDDIVQQIKGALLKVLSDHYLHAVKKQAQNFYIYKCDEQGNPVEKLKLTDGDKVTWRVEV
ANKKSFWYDYNNALDLSLHTQGSGNLSKNVSKHRLAPAMTAKRRNPNVITNSLRKQLVIS
SQGSVSSDNNTQVPLRGKFPANEPDTNNRLSDLLNLQERHNVLQGSIECDNEGVLRFYAG
NGISQALSPSSLNTDFADNSNWFDDICDGRVTAVVELKNGDTFEIQDEQSSAWVATTPPD
YAPQIEPIVTMYDMVSGAALKEQDLDNLTTQFSDVFPILYRLYRMQWVNQADFTDNAVNT
QIRELNSELGFAQLLDNSASAKSLREGIFNQFRNPLFDQDIDVDDPGQSSNEWVSNSRII
PSKDETNIAAKPATSSLKLPFYPNDGIDYPGSPVQWFAIPPFMYQHLQNWAAGDFSVTQV
EKESANTIEELGLFYSEQFKNSPNSALLCARGALDALYGGGFHPGVELTWPMRHNLIYSQ
NDYVSSVTPEINLLGLREFRLKQDLQGLNSPNMYQDFGHVIAVDNVTASIDPNSDAAWLW
RSTPGDLTKWMGIPWQSDAASCQAVYTPEDFPIPSWXAANLPVHVLPLARYNKFKDSQSA
DLPEINGMTHSIAQGMSEETFEHLRLEQFSQRLDWLHTADLGFVGYHAEGGYTNGLIQMV
SQWKNMAMVMARPVENPGSSGIPNVVYVAYSQADKD
>6EERD:GoxA
MSNCQYKIYPPLGIARVGNGPAIKPLSLSTPEVPWAHLYDTNVQYLVTQQELEQLLEEAF
GGNVINEISQIKTKLDERKAEKFKQEEIETITGLLGLSHLVPQQQLSRSLDNLELKSTKD
SDDIVQQIKGALLKVLSDHYLHAVKKQAQNFYIYKCDEQGNPVEKLKLTDGDKVTWRVEV
ANKKSFWYDYNNALDLSLHTQGSGNLSKNVSKHRLAPAMTAKRRNPNVITNSLRKQLVIS
SQGSVSSDNNTQVPLRGKFPANEPDTNNRLSDLLNLQERHNVLQGSIECDNEGVLRFYAG
NGISQALSPSSLNTDFADNSNWFDDICDGRVTAVVELKNGDTFEIQDEQSSAWVATTPPD
YAPQIEPIVTMYDMVSGAALKEQDLDNLTTQFSDVFPILYRLYRMQWVNQADFTDNAVNT
QIRELNSELGFAQLLDNSASAKSLREGIFNQFRNPLFDQDIDVDDPGQSSNEWVSNSRII
PSKDETNIAAKPATSSLKLPFYPNDGIDYPGSPVQWFAIPPFMYQHLQNWAAGDFSVTQV
EKESANTIEELGLFYSEQFKNSPNSALLCARGALDALYGGGFHPGVELTWPMRHNLIYSQ
NDYVSSVTPEINLLGLREFRLKQDLQGLNSPNMYQDFGHVIAVDNVTASIDPNSDAAWLW
RSTPGDLTKWMGIPWQSDAASCQAVYTPEDFPIPSWXAANLPVHVLPLARYNKFKDSQSA
DLPEINGMTHSIAQGMSEETFEHLRLEQFSQRLDWLHTADLGFVGYHAEGGYTNGLIQMV
SQWKNMAMVMARPVENPGSSGIPNVVYVAYSQADKD