Sequence (fasta): 6e13Download

>6E13A:Coenzyme PQQ synthesis protein B
MMYIQVLGSAAAGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPD
IRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLT
TGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGD
NLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTG
REMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGM
SIELLEHH