Sequence (fasta): 6dhfDownload

>6DHFA:Photosystem II protein D1 1
ANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGS
LLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQ
WELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEH
NILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVA
AHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAK
GNVINTWADIINRANLGMEVMHERNAHNFPLDLA
>6DHFa:Photosystem II protein D1 1
ANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGS
LLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQ
WELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEH
NILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVA
AHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAK
GNVINTWADIINRANLGMEVMHERNAHNFPLDLA
>6DHFK:Photosystem II reaction center protein K
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
>6DHFk:Photosystem II reaction center protein K
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
>6DHFL:Photosystem II reaction center protein L
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
>6DHFl:Photosystem II reaction center protein L
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
>6DHFM:Photosystem II reaction center protein M
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQ
>6DHFm:Photosystem II reaction center protein M
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQ
>6DHFO:Photosystem II manganese-stabilizing polypeptide
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQE
AEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTV
KNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEEL
ARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYAS
IEPA
>6DHFo:Photosystem II manganese-stabilizing polypeptide
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQE
AEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTV
KNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEEL
ARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYAS
IEPA
>6DHFT:Photosystem II reaction center protein T
METITYVFIFACIIALFFFAIFFREPPRIT
>6DHFt:Photosystem II reaction center protein T
METITYVFIFACIIALFFFAIFFREPPRIT
>6DHFU:Photosystem II 12 kDa extrinsic protein
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGL
TERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
>6DHFu:Photosystem II 12 kDa extrinsic protein
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGL
TERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
>6DHFV:Cytochrome c-550
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLA
LATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHIL
VEPKILGDKWGGGKVYY
>6DHFv:Cytochrome c-550
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLA
LATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHIL
VEPKILGDKWGGGKVYY
>6DHFY:Photosystem II reaction center protein Ycf12
EVIAQLTMIAMIGIAGPMIIFLLAVRRGNL
>6DHFy:Photosystem II reaction center protein Ycf12
EVIAQLTMIAMIGIAGPMIIFLLAVRRGNL
>6DHFX:Photosystem II reaction center X protein
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQR
>6DHFx:Photosystem II reaction center X protein
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQR
>6DHFZ:Photosystem II reaction center protein Z
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFF
VV
>6DHFz:Photosystem II reaction center protein Z
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFF
VV
>6DHFB:Photosystem II CP47 reaction center protein
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMF
VLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLE
LFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPV
APEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSS
IAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEA
WSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPA
FFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYA
RKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSG
IDPELSPEQVEWGFYQKVGDVTTRR
>6DHFb:Photosystem II CP47 reaction center protein
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMF
VLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLE
LFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPV
APEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSS
IAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEA
WSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPA
FFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYA
RKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSG
IDPELSPEQVEWGFYQKVGDVTTRR
>6DHFR:Photosystem II protein Y
DWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLL
>6DHFr:Photosystem II protein Y
DWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLL
>6DHFC:Photosystem II CP43 reaction center protein
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMY
EQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEE
YSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNP
TLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARR
AFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQ
KLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKN
DIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHL
WHAGRARAAAAGFEKGIDRESEPVLSMPSLD
>6DHFc:Photosystem II CP43 reaction center protein
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMY
EQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEE
YSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNP
TLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARR
AFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQ
KLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKN
DIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHL
WHAGRARAAAAGFEKGIDRESEPVLSMPSLD
>6DHFD:Photosystem II D2 protein
RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGC
NFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFE
IARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNW
TLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANR
FWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEF
ETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
>6DHFd:Photosystem II D2 protein
RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGC
NFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFE
IARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNW
TLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANR
FWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEF
ETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
>6DHFE:Cytochrome b559 subunit alpha
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRS
IPLVTDRFEAKQQVETFLEQLK
>6DHFe:Cytochrome b559 subunit alpha
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRS
IPLVTDRFEAKQQVETFLEQLK
>6DHFF:Cytochrome b559 subunit beta
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
>6DHFf:Cytochrome b559 subunit beta
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
>6DHFH:Photosystem II reaction center protein H
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVS
WKALG
>6DHFh:Photosystem II reaction center protein H
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVS
WKALG
>6DHFI:Photosystem II reaction center protein I
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKD
>6DHFi:Photosystem II reaction center protein I
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKD
>6DHFJ:Photosystem II reaction center protein J
GGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
>6DHFj:Photosystem II reaction center protein J
GGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
PDBj@FacebookPDBj@TwitterwwPDBwwPDB Foundation

Copyright © 2013-2019 Protein Data Bank Japan