Sequence (fasta): 6dheDownload

>6DHEA:Photosystem II protein D1 1
ANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGS
LLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQ
WELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEH
NILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVA
AHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAK
GNVINTWADIINRANLGMEVMHERNAHNFPLDLA
>6DHEa:Photosystem II protein D1 1
ANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGS
LLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQ
WELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEH
NILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVA
AHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAK
GNVINTWADIINRANLGMEVMHERNAHNFPLDLA
>6DHEK:Photosystem II reaction center protein K
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
>6DHEk:Photosystem II reaction center protein K
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
>6DHEL:Photosystem II reaction center protein L
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
>6DHEl:Photosystem II reaction center protein L
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
>6DHEM:Photosystem II reaction center protein M
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQ
>6DHEm:Photosystem II reaction center protein M
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQ
>6DHEO:Photosystem II manganese-stabilizing polypeptide
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQE
AEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTV
KNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEEL
ARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYAS
IEPA
>6DHEo:Photosystem II manganese-stabilizing polypeptide
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQE
AEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTV
KNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEEL
ARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYAS
IEPA
>6DHET:Photosystem II reaction center protein T
METITYVFIFACIIALFFFAIFFREPPRIT
>6DHEt:Photosystem II reaction center protein T
METITYVFIFACIIALFFFAIFFREPPRIT
>6DHEU:Photosystem II 12 kDa extrinsic protein
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGL
TERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
>6DHEu:Photosystem II 12 kDa extrinsic protein
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGL
TERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
>6DHEV:Cytochrome c-550
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLA
LATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHIL
VEPKILGDKWGGGKVYY
>6DHEv:Cytochrome c-550
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLA
LATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHIL
VEPKILGDKWGGGKVYY
>6DHEY:Photosystem II reaction center protein Ycf12
EVIAQLTMIAMIGIAGPMIIFLLAVRRGNL
>6DHEy:Photosystem II reaction center protein Ycf12
EVIAQLTMIAMIGIAGPMIIFLLAVRRGNL
>6DHEX:Photosystem II reaction center X protein
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQR
>6DHEx:Photosystem II reaction center X protein
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQR
>6DHEZ:Photosystem II reaction center protein Z
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFF
VV
>6DHEz:Photosystem II reaction center protein Z
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFF
VV
>6DHEB:Photosystem II CP47 reaction center protein
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMF
VLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLE
LFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPV
APEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSS
IAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEA
WSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPA
FFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYA
RKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSG
IDPELSPEQVEWGFYQKVGDVTTRR
>6DHEb:Photosystem II CP47 reaction center protein
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMF
VLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLE
LFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPV
APEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSS
IAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEA
WSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPA
FFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYA
RKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSG
IDPELSPEQVEWGFYQKVGDVTTRR
>6DHER:Photosystem II protein Y
DWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLL
>6DHEr:Photosystem II protein Y
DWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLL
>6DHEC:Photosystem II CP43 reaction center protein
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMY
EQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEE
YSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNP
TLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARR
AFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQ
KLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKN
DIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHL
WHAGRARAAAAGFEKGIDRESEPVLSMPSLD
>6DHEc:Photosystem II CP43 reaction center protein
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMY
EQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEE
YSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNP
TLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARR
AFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQ
KLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKN
DIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHL
WHAGRARAAAAGFEKGIDRESEPVLSMPSLD
>6DHED:Photosystem II D2 protein
RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGC
NFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFE
IARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNW
TLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANR
FWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEF
ETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
>6DHEd:Photosystem II D2 protein
RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGC
NFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFE
IARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNW
TLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANR
FWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEF
ETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
>6DHEE:Cytochrome b559 subunit alpha
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRS
IPLVTDRFEAKQQVETFLEQLK
>6DHEe:Cytochrome b559 subunit alpha
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRS
IPLVTDRFEAKQQVETFLEQLK
>6DHEF:Cytochrome b559 subunit beta
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
>6DHEf:Cytochrome b559 subunit beta
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
>6DHEH:Photosystem II reaction center protein H
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVS
WKALG
>6DHEh:Photosystem II reaction center protein H
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVS
WKALG
>6DHEI:Photosystem II reaction center protein I
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKD
>6DHEi:Photosystem II reaction center protein I
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKD
>6DHEJ:Photosystem II reaction center protein J
GGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
>6DHEj:Photosystem II reaction center protein J
GGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
PDBj@FacebookPDBj@TwitterwwPDBwwPDB Foundation

Copyright © 2013-2019 Protein Data Bank Japan