Sequence (fasta): 6df9Download

>6DF9A:Transcriptional regulator Kaiso
MANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAQYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCR
SLQIRQYAYLSDRS
>6DF9D:DNA (5'-D(*TP*GP*CP*TP*TP*CP*CP*TP*GP*CP*CP*AP*AP*TP*AP*AP*CP*G)-3')
TGCTTCCTGCCAATAACG
>6DF9E:DNA (5'-D(*CP*GP*TP*TP*AP*TP*TP*GP*GP*CP*AP*GP*GP*AP*AP*GP*CP*A)-3')
CGTTATTGGCAGGAAGCA