Sequence (fasta): 6d73Download

>6D73B:Transient receptor potential cation channel, subfamily M
MALGTSGVKIHPNGNSNQLGVQLENVKLTSLFKKLDKRCSLASWIKENIKKKECCFYVED
GREGICKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGGLGQKTGKYV
RVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGA
WILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAY
YSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVEIELRARLEKLISKLSLGNRESGVTI
PVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRLL
KRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRS
DEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLL
LENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHV
SEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLF
LWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEK
QAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWC
GELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGK
IKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQTSP
SWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLIC
RLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSI
WVVAYGVAKQGILIENEERLNWIIRGAVYEPYITIFGNFPTNIDNTLFDISSCSVNASDP
LKPKCPMLNADNTPVFPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWK
FQRYELIKEYHSRPALPPPFILLSHLILFIRGVFLRDLPQRHKNFRQELEQTEEEELLSW
EAYMKDNYLASTRQDESQSVEHRIHDTAEKVGAMSELLEREQEMVXXXXXXXXXXXXXXX
XXXXXXXDEEAPHMFARQLQYPDSTVRRFPVPEEKVSWEVNFSPYQPPVYNQQDSSESDT
SALDKHRNPGGRTGIRGKGALNTLGPNHILHPIFTRWRDAEHKVLEFLAVWEDAEKRWAL
LGGPAQPDEPLAQVLERILGKKLNEKTKTLLKAGEEVYKGYVDDSRNTDNAWVETSIITL
HCDKNTPLMADLNHMVESSLSSHQPLQWREVSSDACRCSYQREALRQIAHHHNTYFSNSL
EVLFQGPDYKDDDDKAHHHHHHHHHH
>6D73A:Transient receptor potential cation channel, subfamily M
MALGTSGVKIHPNGNSNQLGVQLENVKLTSLFKKLDKRCSLASWIKENIKKKECCFYVED
GREGICKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGGLGQKTGKYV
RVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGA
WILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAY
YSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVEIELRARLEKLISKLSLGNRESGVTI
PVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRLL
KRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRS
DEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLL
LENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHV
SEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLF
LWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEK
QAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWC
GELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGK
IKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQTSP
SWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLIC
RLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSI
WVVAYGVAKQGILIENEERLNWIIRGAVYEPYITIFGNFPTNIDNTLFDISSCSVNASDP
LKPKCPMLNADNTPVFPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWK
FQRYELIKEYHSRPALPPPFILLSHLILFIRGVFLRDLPQRHKNFRQELEQTEEEELLSW
EAYMKDNYLASTRQDESQSVEHRIHDTAEKVGAMSELLEREQEMVXXXXXXXXXXXXXXX
XXXXXXXDEEAPHMFARQLQYPDSTVRRFPVPEEKVSWEVNFSPYQPPVYNQQDSSESDT
SALDKHRNPGGRTGIRGKGALNTLGPNHILHPIFTRWRDAEHKVLEFLAVWEDAEKRWAL
LGGPAQPDEPLAQVLERILGKKLNEKTKTLLKAGEEVYKGYVDDSRNTDNAWVETSIITL
HCDKNTPLMADLNHMVESSLSSHQPLQWREVSSDACRCSYQREALRQIAHHHNTYFSNSL
EVLFQGPDYKDDDDKAHHHHHHHHHH
>6D73C:Transient receptor potential cation channel, subfamily M
MALGTSGVKIHPNGNSNQLGVQLENVKLTSLFKKLDKRCSLASWIKENIKKKECCFYVED
GREGICKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGGLGQKTGKYV
RVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGA
WILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAY
YSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVEIELRARLEKLISKLSLGNRESGVTI
PVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRLL
KRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRS
DEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLL
LENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHV
SEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLF
LWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEK
QAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWC
GELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGK
IKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQTSP
SWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLIC
RLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSI
WVVAYGVAKQGILIENEERLNWIIRGAVYEPYITIFGNFPTNIDNTLFDISSCSVNASDP
LKPKCPMLNADNTPVFPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWK
FQRYELIKEYHSRPALPPPFILLSHLILFIRGVFLRDLPQRHKNFRQELEQTEEEELLSW
EAYMKDNYLASTRQDESQSVEHRIHDTAEKVGAMSELLEREQEMVXXXXXXXXXXXXXXX
XXXXXXXDEEAPHMFARQLQYPDSTVRRFPVPEEKVSWEVNFSPYQPPVYNQQDSSESDT
SALDKHRNPGGRTGIRGKGALNTLGPNHILHPIFTRWRDAEHKVLEFLAVWEDAEKRWAL
LGGPAQPDEPLAQVLERILGKKLNEKTKTLLKAGEEVYKGYVDDSRNTDNAWVETSIITL
HCDKNTPLMADLNHMVESSLSSHQPLQWREVSSDACRCSYQREALRQIAHHHNTYFSNSL
EVLFQGPDYKDDDDKAHHHHHHHHHH
>6D73D:Transient receptor potential cation channel, subfamily M
MALGTSGVKIHPNGNSNQLGVQLENVKLTSLFKKLDKRCSLASWIKENIKKKECCFYVED
GREGICKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGGLGQKTGKYV
RVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGA
WILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAY
YSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVEIELRARLEKLISKLSLGNRESGVTI
PVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRLL
KRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRS
DEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLL
LENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHV
SEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLF
LWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEK
QAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWC
GELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGK
IKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQTSP
SWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLIC
RLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSI
WVVAYGVAKQGILIENEERLNWIIRGAVYEPYITIFGNFPTNIDNTLFDISSCSVNASDP
LKPKCPMLNADNTPVFPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWK
FQRYELIKEYHSRPALPPPFILLSHLILFIRGVFLRDLPQRHKNFRQELEQTEEEELLSW
EAYMKDNYLASTRQDESQSVEHRIHDTAEKVGAMSELLEREQEMVXXXXXXXXXXXXXXX
XXXXXXXDEEAPHMFARQLQYPDSTVRRFPVPEEKVSWEVNFSPYQPPVYNQQDSSESDT
SALDKHRNPGGRTGIRGKGALNTLGPNHILHPIFTRWRDAEHKVLEFLAVWEDAEKRWAL
LGGPAQPDEPLAQVLERILGKKLNEKTKTLLKAGEEVYKGYVDDSRNTDNAWVETSIITL
HCDKNTPLMADLNHMVESSLSSHQPLQWREVSSDACRCSYQREALRQIAHHHNTYFSNSL
EVLFQGPDYKDDDDKAHHHHHHHHHH