Sequence (fasta): 6c84Download

>6C84A:Penicillin-binding protein
HHHHHHSSGLVPRGSHMQETQAVEAGEKTVEQFVQALNKGDYNKAAGMASKKAANKSALS
EKEILEKYQNIYGAADVKGLEISNLKVDKKDDSTYSFSYKAKMNTSLGELKDLSYKGTLD
RNDGKTTINWQPNLVFPEMEGNDKVSLTTQEATRGNILDRNGEPLATTGKLKQLGVVPSK
LGDGDEKTANIKAIASAFDLTEDAINQAISQSWVQPDYFVPLKIIDGATPELPAGATIQE
VDGRYYPLGEAAAQLIGYVGDITAEDIDKNPELSSNGKIGRSGLEMAFDKDLRGTTGGKL
SITDTDGVEKKVLIEHEVQNGKDIKLTIDAKAQKTAFDSLGGKAGSTVATTPKTGDLLAL
ASSPSYDPNKMTNGISQEDYKAYEENPEQPFISRFATGYAPGSTFKMITAAIGLDNGTID
PNEVLTINGLKWQKDSSWGSYQVTRVSDVSQVDLKTALIYSDNIYMAQETLKMGEKNFRA
GLDKFIFGEDLDLPISMNPAQISNEESFNSDILLADTGYGQGELLINPIQQAAMYSVFAN
NGTLVYPKLIADKETKDKKNVIGETAVQTIVPDLREVVQDVNGTAHSLSALGIPLAAKTG
TAEIKEKQDEKGKENSFLFAFNPDNQEYMMVSMLENKEDDDSATKRAPELLQYLNQNYQ
>6C84B:Penicillin-binding protein
HHHHHHSSGLVPRGSHMQETQAVEAGEKTVEQFVQALNKGDYNKAAGMASKKAANKSALS
EKEILEKYQNIYGAADVKGLEISNLKVDKKDDSTYSFSYKAKMNTSLGELKDLSYKGTLD
RNDGKTTINWQPNLVFPEMEGNDKVSLTTQEATRGNILDRNGEPLATTGKLKQLGVVPSK
LGDGDEKTANIKAIASAFDLTEDAINQAISQSWVQPDYFVPLKIIDGATPELPAGATIQE
VDGRYYPLGEAAAQLIGYVGDITAEDIDKNPELSSNGKIGRSGLEMAFDKDLRGTTGGKL
SITDTDGVEKKVLIEHEVQNGKDIKLTIDAKAQKTAFDSLGGKAGSTVATTPKTGDLLAL
ASSPSYDPNKMTNGISQEDYKAYEENPEQPFISRFATGYAPGSTFKMITAAIGLDNGTID
PNEVLTINGLKWQKDSSWGSYQVTRVSDVSQVDLKTALIYSDNIYMAQETLKMGEKNFRA
GLDKFIFGEDLDLPISMNPAQISNEESFNSDILLADTGYGQGELLINPIQQAAMYSVFAN
NGTLVYPKLIADKETKDKKNVIGETAVQTIVPDLREVVQDVNGTAHSLSALGIPLAAKTG
TAEIKEKQDEKGKENSFLFAFNPDNQEYMMVSMLENKEDDDSATKRAPELLQYLNQNYQ