Sequence (fasta): 6c44Download

>6C44A:Capsid protein
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAILAFLRFTAIK
PSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKKRR
>6C44B:Capsid protein
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAILAFLRFTAIK
PSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKKRR