Sequence (fasta): 6c2cDownload

>6C2CA:dihydrocoumarin hydrolase, AncDHCH1
GTIGSMAAAPQVKTQAPGFYRMMLGDFEVTALSDGTVDLPVDKLLNQPPAKTQSALAKSF
LKAPLETSVNAYLVNTGSKLVLVDTGAAGLFGPTLGKLAANLKAAGYQPEQVDEIYITHM
HPDHVGGLMANEQAAFPNAVVRADQKDADFWLSQANLDKAPDDEKGFFQGAMASLNPYVK
AGKFKPFSGNTDLVPGIKALASHGHTPGHTTYVVESKGQKLVLLGDLIHVAAVQFDDPSV
TIQFDSDSKAAAAERKKAFADAAKGGYLIGAAHLSFPGIGHIRADGKGYRFVPVNYSVA
>6C2CB:dihydrocoumarin hydrolase, AncDHCH1
GTIGSMAAAPQVKTQAPGFYRMMLGDFEVTALSDGTVDLPVDKLLNQPPAKTQSALAKSF
LKAPLETSVNAYLVNTGSKLVLVDTGAAGLFGPTLGKLAANLKAAGYQPEQVDEIYITHM
HPDHVGGLMANEQAAFPNAVVRADQKDADFWLSQANLDKAPDDEKGFFQGAMASLNPYVK
AGKFKPFSGNTDLVPGIKALASHGHTPGHTTYVVESKGQKLVLLGDLIHVAAVQFDDPSV
TIQFDSDSKAAAAERKKAFADAAKGGYLIGAAHLSFPGIGHIRADGKGYRFVPVNYSVA