Sequence (fasta): 6bpyDownload

>6BPYA:Thioredoxin reductase
GMVHTKVVIIGSGPAAHTAAIYLSRAELKPVLYEGMLANGTAAGGQLTTTTDIENFPGFP
DGIGGAELMENMRKQSIRFGTEVITETISRVDLSSKPFKLWTEWNDGPDKEPACTADAVI
IATGANARRLNLPGEETYWQNGISACAVCDGAVPIFRNKPLYVIGGGDSAAEEAMFLAKY
GSSVTVLVRRDKLRASKAMAKRLLAHPKVTVRFNTVATEVLGEKKPNGLMTHLRIKNTVT
GEEEIVDANGLFYAVGHDPATALVKGQIDLDEDGYIITKPGTSYTSREGVFACGDVQDKR
YRQAITSAGSGCIAALEAEKFIAEAESPEEEPVAVSAQKSADNSTIQPAAQEVNGDVKKD
PKGAVPEYKSNPLL
>6BPYB:Thioredoxin reductase
GMVHTKVVIIGSGPAAHTAAIYLSRAELKPVLYEGMLANGTAAGGQLTTTTDIENFPGFP
DGIGGAELMENMRKQSIRFGTEVITETISRVDLSSKPFKLWTEWNDGPDKEPACTADAVI
IATGANARRLNLPGEETYWQNGISACAVCDGAVPIFRNKPLYVIGGGDSAAEEAMFLAKY
GSSVTVLVRRDKLRASKAMAKRLLAHPKVTVRFNTVATEVLGEKKPNGLMTHLRIKNTVT
GEEEIVDANGLFYAVGHDPATALVKGQIDLDEDGYIITKPGTSYTSREGVFACGDVQDKR
YRQAITSAGSGCIAALEAEKFIAEAESPEEEPVAVSAQKSADNSTIQPAAQEVNGDVKKD
PKGAVPEYKSNPLL
PDBj@FacebookPDBj@TwitterwwPDBwwPDB Foundation

Copyright © 2013-2019 Protein Data Bank Japan