Sequence (fasta): 6bpqDownload

>6BPQA:Transient receptor potential cation channel subfamily M member 8
XXXXXXXXXXXXXXXXXXXXCDTDSETLYDLMTQHWHLKTPNLVISVTGGAKNFALKPRM
RKIFSRLIYIAQSKGAWIFTGGTHYGLMKYIGEVVRDNTISRSSEENVVAIGIAXXXXXL
KRDPLYCLDNNHTHLLLVDNGTHGHPTIEAKVRTQLEKYISERVIPESNYGGKIPIVCFA
QGGGKETLKSINVAIKSKIPCVVVEGSGRIADVIASLVEAEGTLASSCVKESLLRFLPRT
ISRLSEEETESWIKWIKEVLESPHLLTVIKIEEAGDEIVSNAISFALYKAFSTNEHDRDN
WNGQLKLLLEWNQLDLASDEIFTNDRNWESADLQDVMFTALVKDRPKFVRLFLENGLNLR
KFLTTEVLRELYTNNFSSLVFKNLQIAKNSYNDALLTFVWKMVEDFRRGAKRDDKNSKDE
MEIELSEECPITRHPLQALFIWSVLQNKKELSKVIWEQTRGCTLAALGASKLLKSMAKVK
NDINAAGESEELANEYETRAVELFTECYSNDEDLAEQLLTYSCEAWGGSNCLELAVEARD
QQFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFFFPLIGCGFISFRKKPVEKTKKLFL
YYVSFFTSPFVVFSWNVIFYIAFLLLFAYVLLMDFQKEPTALEIILYVLVFILLCDEVRQ
WYMNGSKYFSDLWNVMDTLAIFYFIAGIVFRLHSDESSWYSGRVIFCLDYIVFTLRLIHI
FTVSRNLGPKIIMLQRMMIDVFFFLFLFAVWMVAFGVARQGILRKNEHRWEWIFRSVIYE
PYLAMFGQYPDDIDGTTYNFDHCTFSGNESKPLCVELDANNQPRFPEWITIPLVCIYMLS
TNILLVNLLVAMFGYTVGSVQENNDQVWKFQRFFLVQEYCSRLTXXXXXXXXXXXXXXXX
XXRNEDNEILAWEAVMKENYLVKINTXXXXXXXXXXXXXXXXXXXXXXXX
>6BPQB:Transient receptor potential cation channel subfamily M member 8
XXXXXXXXXXXXXXXXXXXXCDTDSETLYDLMTQHWHLKTPNLVISVTGGAKNFALKPRM
RKIFSRLIYIAQSKGAWIFTGGTHYGLMKYIGEVVRDNTISRSSEENVVAIGIAXXXXXL
KRDPLYCLDNNHTHLLLVDNGTHGHPTIEAKVRTQLEKYISERVIPESNYGGKIPIVCFA
QGGGKETLKSINVAIKSKIPCVVVEGSGRIADVIASLVEAEGTLASSCVKESLLRFLPRT
ISRLSEEETESWIKWIKEVLESPHLLTVIKIEEAGDEIVSNAISFALYKAFSTNEHDRDN
WNGQLKLLLEWNQLDLASDEIFTNDRNWESADLQDVMFTALVKDRPKFVRLFLENGLNLR
KFLTTEVLRELYTNNFSSLVFKNLQIAKNSYNDALLTFVWKMVEDFRRGAKRDDKNSKDE
MEIELSEECPITRHPLQALFIWSVLQNKKELSKVIWEQTRGCTLAALGASKLLKSMAKVK
NDINAAGESEELANEYETRAVELFTECYSNDEDLAEQLLTYSCEAWGGSNCLELAVEARD
QQFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFFFPLIGCGFISFRKKPVEKTKKLFL
YYVSFFTSPFVVFSWNVIFYIAFLLLFAYVLLMDFQKEPTALEIILYVLVFILLCDEVRQ
WYMNGSKYFSDLWNVMDTLAIFYFIAGIVFRLHSDESSWYSGRVIFCLDYIVFTLRLIHI
FTVSRNLGPKIIMLQRMMIDVFFFLFLFAVWMVAFGVARQGILRKNEHRWEWIFRSVIYE
PYLAMFGQYPDDIDGTTYNFDHCTFSGNESKPLCVELDANNQPRFPEWITIPLVCIYMLS
TNILLVNLLVAMFGYTVGSVQENNDQVWKFQRFFLVQEYCSRLTXXXXXXXXXXXXXXXX
XXRNEDNEILAWEAVMKENYLVKINTXXXXXXXXXXXXXXXXXXXXXXXX
>6BPQC:Transient receptor potential cation channel subfamily M member 8
XXXXXXXXXXXXXXXXXXXXCDTDSETLYDLMTQHWHLKTPNLVISVTGGAKNFALKPRM
RKIFSRLIYIAQSKGAWIFTGGTHYGLMKYIGEVVRDNTISRSSEENVVAIGIAXXXXXL
KRDPLYCLDNNHTHLLLVDNGTHGHPTIEAKVRTQLEKYISERVIPESNYGGKIPIVCFA
QGGGKETLKSINVAIKSKIPCVVVEGSGRIADVIASLVEAEGTLASSCVKESLLRFLPRT
ISRLSEEETESWIKWIKEVLESPHLLTVIKIEEAGDEIVSNAISFALYKAFSTNEHDRDN
WNGQLKLLLEWNQLDLASDEIFTNDRNWESADLQDVMFTALVKDRPKFVRLFLENGLNLR
KFLTTEVLRELYTNNFSSLVFKNLQIAKNSYNDALLTFVWKMVEDFRRGAKRDDKNSKDE
MEIELSEECPITRHPLQALFIWSVLQNKKELSKVIWEQTRGCTLAALGASKLLKSMAKVK
NDINAAGESEELANEYETRAVELFTECYSNDEDLAEQLLTYSCEAWGGSNCLELAVEARD
QQFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFFFPLIGCGFISFRKKPVEKTKKLFL
YYVSFFTSPFVVFSWNVIFYIAFLLLFAYVLLMDFQKEPTALEIILYVLVFILLCDEVRQ
WYMNGSKYFSDLWNVMDTLAIFYFIAGIVFRLHSDESSWYSGRVIFCLDYIVFTLRLIHI
FTVSRNLGPKIIMLQRMMIDVFFFLFLFAVWMVAFGVARQGILRKNEHRWEWIFRSVIYE
PYLAMFGQYPDDIDGTTYNFDHCTFSGNESKPLCVELDANNQPRFPEWITIPLVCIYMLS
TNILLVNLLVAMFGYTVGSVQENNDQVWKFQRFFLVQEYCSRLTXXXXXXXXXXXXXXXX
XXRNEDNEILAWEAVMKENYLVKINTXXXXXXXXXXXXXXXXXXXXXXXX
>6BPQD:Transient receptor potential cation channel subfamily M member 8
XXXXXXXXXXXXXXXXXXXXCDTDSETLYDLMTQHWHLKTPNLVISVTGGAKNFALKPRM
RKIFSRLIYIAQSKGAWIFTGGTHYGLMKYIGEVVRDNTISRSSEENVVAIGIAXXXXXL
KRDPLYCLDNNHTHLLLVDNGTHGHPTIEAKVRTQLEKYISERVIPESNYGGKIPIVCFA
QGGGKETLKSINVAIKSKIPCVVVEGSGRIADVIASLVEAEGTLASSCVKESLLRFLPRT
ISRLSEEETESWIKWIKEVLESPHLLTVIKIEEAGDEIVSNAISFALYKAFSTNEHDRDN
WNGQLKLLLEWNQLDLASDEIFTNDRNWESADLQDVMFTALVKDRPKFVRLFLENGLNLR
KFLTTEVLRELYTNNFSSLVFKNLQIAKNSYNDALLTFVWKMVEDFRRGAKRDDKNSKDE
MEIELSEECPITRHPLQALFIWSVLQNKKELSKVIWEQTRGCTLAALGASKLLKSMAKVK
NDINAAGESEELANEYETRAVELFTECYSNDEDLAEQLLTYSCEAWGGSNCLELAVEARD
QQFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFFFPLIGCGFISFRKKPVEKTKKLFL
YYVSFFTSPFVVFSWNVIFYIAFLLLFAYVLLMDFQKEPTALEIILYVLVFILLCDEVRQ
WYMNGSKYFSDLWNVMDTLAIFYFIAGIVFRLHSDESSWYSGRVIFCLDYIVFTLRLIHI
FTVSRNLGPKIIMLQRMMIDVFFFLFLFAVWMVAFGVARQGILRKNEHRWEWIFRSVIYE
PYLAMFGQYPDDIDGTTYNFDHCTFSGNESKPLCVELDANNQPRFPEWITIPLVCIYMLS
TNILLVNLLVAMFGYTVGSVQENNDQVWKFQRFFLVQEYCSRLTXXXXXXXXXXXXXXXX
XXRNEDNEILAWEAVMKENYLVKINTXXXXXXXXXXXXXXXXXXXXXXXX
PDBj@FacebookPDBj@TwitterwwPDBwwPDB FoundationEM DataBank

Copyright © 2013-2018 Protein Data Bank Japan