Sequence (fasta): 6akmDownload

>6AKMA:Suppressor of IKBKE 1
STMAIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASD
MKDMS
>6AKMB:Sarcolemmal membrane-associated protein
STMEQLSQYLQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGN
QLQA