Sequence (fasta): 5zo1Download

>5ZO1A:Cell adhesion molecule 4
QEVQTEQVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLEEFSP
RRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELS
CLVPRSRPAAVLRWYRDRKELKGVSSGQENGKVWSVASTVRFRVDRKDDGGIVICEAQNQ
ALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGQES
LPERAEAVGETLTLPGLVSADQGTYTCEAANKHGHARALYVLVVYDPGAVVEAHHHHHH