Sequence (fasta): 5zi0Download

>5ZI0A:3-oxoacyl-acyl carrier protein reductase
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRMTDRLKDKVAIITGGVAGIGLGIAECYV
REGAKVVVTANHNVDGGRAAVAKFGDDVSLFVQQDVSKEADWQKVIDATIAKFGRVDILV
NNAGIGGVNTAIEDLDLADWQKVIDVNLTANFLGEKAAIKAMKQTADAKGSIINVSSVAG
LVGLPIDPAYSASKGGSRLLTHATALNLAQRGIDIRVNSVHPGWIDTSIIPEDLRKQIIA
TIPVGHMGQPQDIGEVCVYLGSDESRFANGAEFTVDGGQRA
>5ZI0B:3-oxoacyl-acyl carrier protein reductase
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRMTDRLKDKVAIITGGVAGIGLGIAECYV
REGAKVVVTANHNVDGGRAAVAKFGDDVSLFVQQDVSKEADWQKVIDATIAKFGRVDILV
NNAGIGGVNTAIEDLDLADWQKVIDVNLTANFLGEKAAIKAMKQTADAKGSIINVSSVAG
LVGLPIDPAYSASKGGSRLLTHATALNLAQRGIDIRVNSVHPGWIDTSIIPEDLRKQIIA
TIPVGHMGQPQDIGEVCVYLGSDESRFANGAEFTVDGGQRA
>5ZI0C:3-oxoacyl-acyl carrier protein reductase
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRMTDRLKDKVAIITGGVAGIGLGIAECYV
REGAKVVVTANHNVDGGRAAVAKFGDDVSLFVQQDVSKEADWQKVIDATIAKFGRVDILV
NNAGIGGVNTAIEDLDLADWQKVIDVNLTANFLGEKAAIKAMKQTADAKGSIINVSSVAG
LVGLPIDPAYSASKGGSRLLTHATALNLAQRGIDIRVNSVHPGWIDTSIIPEDLRKQIIA
TIPVGHMGQPQDIGEVCVYLGSDESRFANGAEFTVDGGQRA
>5ZI0D:3-oxoacyl-acyl carrier protein reductase
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRMTDRLKDKVAIITGGVAGIGLGIAECYV
REGAKVVVTANHNVDGGRAAVAKFGDDVSLFVQQDVSKEADWQKVIDATIAKFGRVDILV
NNAGIGGVNTAIEDLDLADWQKVIDVNLTANFLGEKAAIKAMKQTADAKGSIINVSSVAG
LVGLPIDPAYSASKGGSRLLTHATALNLAQRGIDIRVNSVHPGWIDTSIIPEDLRKQIIA
TIPVGHMGQPQDIGEVCVYLGSDESRFANGAEFTVDGGQRA