Sequence (fasta): 5z83Download

>5Z83A:C-6' aminotransferase
MGSSHHHHHHSSGLVPRGSHMTIDIGAGKLLAQEPTCPRDADGRPRVFVEGSGAYLTDPD
GRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGVGTAWSPVLDSLLGQLQEVCGGDV
VGLYRTGTAALRSVTCAVRDARDRSIVLSSGYHGYDPMWHCDEPFTPNQHGIVEFLFDLD
VLAEWLSRPEQVAAVVISPDHMHLGERWYTEFTRLTKEADVPVIADEVKVGLRYRAGLST
PLLDPAVWIVAKCLANGSPVAAVGGDAHLLAALEDVSFTSYFEPTAMAAATTTLRRMATG
EPQQAIRAAGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVADAFHAAAAAEGLL
FFEGDNQTPSAAFTDEVVEDACGRIDRVSAALTGRFTDRELTEESWYASAWGAMDGLADR
PRTREETTAIVERLWED
>5Z83B:C-6' aminotransferase
MGSSHHHHHHSSGLVPRGSHMTIDIGAGKLLAQEPTCPRDADGRPRVFVEGSGAYLTDPD
GRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGVGTAWSPVLDSLLGQLQEVCGGDV
VGLYRTGTAALRSVTCAVRDARDRSIVLSSGYHGYDPMWHCDEPFTPNQHGIVEFLFDLD
VLAEWLSRPEQVAAVVISPDHMHLGERWYTEFTRLTKEADVPVIADEVKVGLRYRAGLST
PLLDPAVWIVAKCLANGSPVAAVGGDAHLLAALEDVSFTSYFEPTAMAAATTTLRRMATG
EPQQAIRAAGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVADAFHAAAAAEGLL
FFEGDNQTPSAAFTDEVVEDACGRIDRVSAALTGRFTDRELTEESWYASAWGAMDGLADR
PRTREETTAIVERLWED