Sequence (fasta): 5tj6Download

>5TJ6A:High conductance calcium-activated potassium channel
MASSSSTSCEPGDRQWYSFLASSLVTFGSGLVVIIIYRIVLWLCCRKKKCIQVSNPVPTA
RTTSLDQKSFMKNSDPEIGWMTEAKDWAGELISGQTTTGRILVGLVFLLSIASLIIYFID
ASTNTSVETCLPWSSSTTQQVDLAFNVFFMIYFFIRFVAANDKLWFWVELFSFVDYFTIP
PSFVAIYLDRNWLGLRFLRALRLMSIPDILTYLNVLKTSTLIRLVQLVVSFVSLWLTAAG
FLHLLENSGDPFFDFGNAQHLTYWECLYFLMVTMSTVGFGDIFATTVLGRTFVVIFIMIF
IGLFASFIPEIAEILGKRQKYGGSYKKERGKRHVVVCGYITFDSVSNFLKDFLHKDREDV
DVEIVFLHKGLPGLELEGLLKRHFTQVEYFWGSVMDANDLERVKIQEADACLVLANKYCQ
DPDQEDAANIMRVISIKNYHSDIKVIVQLLQYHNKAYLLNIPSWDWKRGDDAVCVAELKL
GFIAQSCLAPGFSTLMANLFTMRSYKPTPEMSQWQTDYMRGTGMEMYTEYLSSAFNALTF
PEAAELCFSKLKLLLLAIEVRQEDTRESTLAINPGPKVKIENATQGFFIAESAEEVKRAF
YYCKNCHANVSDVRQIKKCKCRPLAMFKKGAAAVLALQRTPGLAVEPDGEANDKDKSRGT
STSKAVTSFPEKRKPQSRRKPSTTLKSKSPSEDSVPPPPPPVDEPRKFDSTGMFHWCPDR
PLNDCLQDRSQASASGLRNHVVVCLFADAASPLIGLRNLVMPLRASNFHYHELKPTIIVG
NLDYLHREWKTLQNFPKLSILPGSPLNRANLRAVNINLCDMCVIVSAKDRNMEDPNLVDK
EAILCSLNIKAMTFDDTMGLIQSSNFVPGGFSPLHENKRSQAGANVPLITELANDSNVQF
LDQDDDDDPDTELYMTQPFACGTAFAVSVLDSLMSTSYFNDNALTLIRTLITGGATPELE
QILAEGAGMRGGYCSPAVLANRDRCRVAQISLFDGPLAQFGQGGHYGELFVYALRHFGIL
CIGLYRFRDTNESVRSPSSKRYVITNPPEDFPLLPTDQVYVLTYKQITNH
PDBj@FacebookPDBj@TwitterwwPDBwwPDB FoundationEM DataBank

Copyright © 2013-2018 Protein Data Bank Japan