Sequence (fasta): 5svxDownload

>5SVXA:MORC family CW-type zinc finger protein 3
SDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPED
>5SVXB:H3K4me3
ARTKQTARKST