Sequence (fasta): 5jjtDownload

>5JJTA:Serine/threonine-protein phosphatase 5
NENSDVSRAEEFKSQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKLEEYG
SAIQDASKAIEVDSRYSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSPNDPDATRKLKEC
EKAVMKLKFEEAISVPVSERRSVAESIDFHTIEVEPQYSGARIEGEEVTLDFVKTMMEDF
KNQKTLHKRYAYQIVLQTRQILLALPSLVDISVPHGKHITVCGDVHGQFYDLLNIFELNG
LPSEENPYLFNGDFVDRGSFSVEIILTLFAFKCMCPSSIYLARGNHESKSMNKIYGFEGE
VRSKLSEKFVDLFAEVFCYLPLAHVINGKVFVVHGGLFSVDGVKLSDIRAIDRFCEPPEE
GLMCELLWSDPQPLPGRGPSKRGVGLSFGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEH
DGKLITVFSAPNYCDQMGNKGAFIRFEAPDMKPNIVTFSAVPHPDVKPMAYANNFLRMF
>5JJTB:Serine/threonine-protein phosphatase 5
NENSDVSRAEEFKSQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKLEEYG
SAIQDASKAIEVDSRYSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSPNDPDATRKLKEC
EKAVMKLKFEEAISVPVSERRSVAESIDFHTIEVEPQYSGARIEGEEVTLDFVKTMMEDF
KNQKTLHKRYAYQIVLQTRQILLALPSLVDISVPHGKHITVCGDVHGQFYDLLNIFELNG
LPSEENPYLFNGDFVDRGSFSVEIILTLFAFKCMCPSSIYLARGNHESKSMNKIYGFEGE
VRSKLSEKFVDLFAEVFCYLPLAHVINGKVFVVHGGLFSVDGVKLSDIRAIDRFCEPPEE
GLMCELLWSDPQPLPGRGPSKRGVGLSFGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEH
DGKLITVFSAPNYCDQMGNKGAFIRFEAPDMKPNIVTFSAVPHPDVKPMAYANNFLRMF