Sequence (fasta): 5im5Download

>5IM5K:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5M:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5O:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5Q:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5S:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5A:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5B:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5C:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5D:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5E:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5F:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5G:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5H:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5I:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5J:Designed Riboflavin synthase
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDI
VMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAI
EHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE
>5IM5P:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM5T:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM5N:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM5V:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM5W:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM5U:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM5Y:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM5Z:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM5X:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM52:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM54:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM51:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM5L:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM5R:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH
>5IM53:Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIMLLRSAQ
PEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPNTVRACQIIGIDIVPGVNNPSTVEAA
LEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGT
WMVDKKLVTNGEWDEIARLTREIVEQVNPGSLEHHHHHH