Sequence (fasta): 5cbxDownload

>5CBXA:AncGR DNA Binding Domain
MHHHHHHSSGVDLGTENLYFQSNAGPPPKICLVCGDEASGCHYGVLTCGSCKVFFKRAVE
GQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKTKK
>5CBXB:AncGR DNA Binding Domain
MHHHHHHSSGVDLGTENLYFQSNAGPPPKICLVCGDEASGCHYGVLTCGSCKVFFKRAVE
GQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKTKK
>5CBXE:AncGR DNA Binding Domain
MHHHHHHSSGVDLGTENLYFQSNAGPPPKICLVCGDEASGCHYGVLTCGSCKVFFKRAVE
GQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKTKK
>5CBXF:AncGR DNA Binding Domain
MHHHHHHSSGVDLGTENLYFQSNAGPPPKICLVCGDEASGCHYGVLTCGSCKVFFKRAVE
GQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKTKK
>5CBXC:DNA (5'-D(*CP*CP*AP*GP*AP*AP*CP*AP*GP*AP*GP*TP*GP*TP*TP*CP*TP*G)-3')
CCAGAACAGAGTGTTCTG
>5CBXH:DNA (5'-D(*CP*CP*AP*GP*AP*AP*CP*AP*GP*AP*GP*TP*GP*TP*TP*CP*TP*G)-3')
CCAGAACAGAGTGTTCTG
>5CBXD:DNA (5'-D(*TP*CP*AP*GP*AP*AP*CP*AP*CP*TP*CP*TP*GP*TP*TP*CP*TP*G)-3')
TCAGAACACTCTGTTCTG
>5CBXG:DNA (5'-D(*TP*CP*AP*GP*AP*AP*CP*AP*CP*TP*CP*TP*GP*TP*TP*CP*TP*G)-3')
TCAGAACACTCTGTTCTG