Sequence (fasta): 5a3bDownload

>5A3BA:SIR2 FAMILY PROTEIN
MGHHHHHHGGMSNWTTYPQKNLTQAEQLAQLIKEADALVVGIGAGMSAADGFTYIGPRFE
TAFPDFIAKYQFLDMLQASLFDFEDWQEYWAFQSRFVALNYLDQPVGQSYLDLKEILETK
DYHIITTNADNAFWVAGYDPHNIFHIQGEYGLWQCSQHCHQQTYKDDTVIRQMIAEQKNM
KVPGQLIPHCPECEAPFEINKRNEEKGMVEDADFHAQKARYEAFLSEHKEGKVLYLEIGV
GHTTPQFIKHPFWKRVSENPNALFVTLNHKHYRIPLSIRRQSLELTEHIAQLISATKTIY
QKS