Sequence (fasta): 4uy4Download

>4UY4A:SPINDLIN-4
SMTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDK
RVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFY
ITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGS
KRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP
>4UY4B:SPINDLIN-4
SMTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDK
RVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFY
ITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGS
KRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP
>4UY4C:HISTONE H3K4ME3
ARTKQT
>4UY4D:HISTONE H3K4ME3
ARTKQT