Sequence (fasta): 4un8Download

>4UN8A:HOMING ENDONUCLEASE I-DMOI
AHNNENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLI
DELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDK
TLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLNISLRDRIKFVHTILSS
HLNPLPPEAAALEHHHHHH
>4UN8D:HOMING ENDONUCLEASE I-DMOI
AHNNENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLI
DELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDK
TLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLNISLRDRIKFVHTILSS
HLNPLPPEAAALEHHHHHH
>4UN8B:25MER
GCCTTGCCGGGTAAGTTCCGGCGCG
>4UN8E:25MER
GCCTTGCCGGGTAAGTTCCGGCGCG
>4UN8H:25MER
GCCTTGCCGGGTAAGTTCCGGCGCG
>4UN8C:25MER
CGCGCCGGAACTTACCCGGCAAGGC
>4UN8F:25MER
CGCGCCGGAACTTACCCGGCAAGGC
>4UN8I:25MER
CGCGCCGGAACTTACCCGGCAAGGC
>4UN8G:HOMING ENDONUCLEASE I-DMOI
AHNNEEVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLI
DELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDK
TLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLNISLRDRIKFVHTILSS
HLNPLPPEAAALEHHHHHH