Sequence (fasta): 4uieDownload

>4UIEA:SURFACE LAYER PROTEIN
EVIDTTLKATVVTKKADLIELDAADNGDALAKLLANLDIKDQNGNPMVDSAATPNTNEKL
QALKSVLSGIVSSDTSVIGSVSNVDNLKDDASISGLAVKKAGTVTLTLVFNEDSKIAPIA
ITVKAPAATQDGVTVTGLDLVPGVTGVGKTKFTATDKIKSGHKLYYAVDDSAVPAPAVGT
TRNSTKFANEITVGTTEVAANAGQIITVIEVDSSDRVVGYKTFTVEAADLSVAADKTGFT
ATVTPTGGNQVTTGKTLLAVSDLANGHKLYAAAAGSSAAAAPVKGIAYTDTTVRTTYGTE
VTSGTVEVDAQDGQHISIIEVDENGKVVGYKDYTITGIQIGTKSAS