Sequence (fasta): 4rrmDownload

>4RRMA:Probable threonine--tRNA ligase 2
MRLLYLHADRFEYKTVKPALKNPPDPPGEASFGEALVVFTTVEDGDGPQTVMYAASDIAS
HSSRLKVTTVILYPYAHLSSRLAKPMAAHKRLIELEGALRTKFPGHVHRAPFGWYKSFSI
ACKGHPLAALSRSFTE
171588
PDB entries from 2020-11-25