Sequence (fasta): 4rrgDownload

>4RRGA:Threonine--tRNA ligase
MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFIAVEREDENNPEGTAIGAVEE
IEKVANQLKVNNIVVYPYAHLSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKEE
>4RRGB:Threonine--tRNA ligase
MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFIAVEREDENNPEGTAIGAVEE
IEKVANQLKVNNIVVYPYAHLSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKEE
>4RRGC:Threonine--tRNA ligase
MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFIAVEREDENNPEGTAIGAVEE
IEKVANQLKVNNIVVYPYAHLSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKEE
>4RRGD:Threonine--tRNA ligase
MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFIAVEREDENNPEGTAIGAVEE
IEKVANQLKVNNIVVYPYAHLSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKEE