Sequence (fasta): 4rrfDownload

>4RRFA:Threonine--tRNA ligase
MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFIAVEREDENNPEGTAIGAVEE
IEKVANQLKVNNIVVYPYAHLSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKEE
>4RRFB:Threonine--tRNA ligase
MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFIAVEREDENNPEGTAIGAVEE
IEKVANQLKVNNIVVYPYAHLSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKEE
>4RRFC:Threonine--tRNA ligase
MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFIAVEREDENNPEGTAIGAVEE
IEKVANQLKVNNIVVYPYAHLSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKEE
>4RRFD:Threonine--tRNA ligase
MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFIAVEREDENNPEGTAIGAVEE
IEKVANQLKVNNIVVYPYAHLSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKEE
>4RRFE:Threonine--tRNA ligase
MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFIAVEREDENNPEGTAIGAVEE
IEKVANQLKVNNIVVYPYAHLSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKEE
>4RRFF:Threonine--tRNA ligase
MKMLLIHSDYLEFEAKEKTKIAEETENLKGKLDECLACFIAVEREDENNPEGTAIGAVEE
IEKVANQLKVNNIVVYPYAHLSSDLSSPETAVKVLKDIESILKERGYNVLRAPFGWYKAF
KISCKGHPLSELSRKIVAKEE