Sequence (fasta): 4rr9Download

>4RR9A:Probable threonine--tRNA ligase 2
MRLLYLHADRFEYKTVKPALKNPPDPPGEASFGEALVVFTTVEDGDGPQTVMYAASDIAS
HSSRLKVTTVILYPYAHLSSRLAKPMAAHKRLIELEGALRTKFPGHVHRAPFGWYKSFSI
ACKGHPLAELSRSFTE