Sequence (fasta): 4qjfDownload

>4QJFA:DNA-directed RNA polymerase, subunit E'
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIV
PGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVF
DEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEK
KKAKEESKGE
>4QJFB:DNA-directed RNA polymerase, subunit F
MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQAR
ELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRP
LE