Sequence (fasta): 4ozjDownload

>4OZJA:Nitrogen regulatory protein P-II
MGSSHHHHHHSSGLVPAGSHMSDADLPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLT
VTNVSGRGSQPAKKSQWRGEEYTVDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDG
KIFILPVENAIQVRTGKTGRDAV