Sequence (fasta): 4oi3Download

>4OI3A:Nickel responsive protein
MHHHHHHMAHFMDVHRGMHGITSDQLHQAHQADLAVEKDENVHFEQAWADPASGTIYCLS
EGPSAEAVQRVHERAGHKADEIHEVPLSA
>4OI3B:Nickel responsive protein
MHHHHHHMAHFMDVHRGMHGITSDQLHQAHQADLAVEKDENVHFEQAWADPASGTIYCLS
EGPSAEAVQRVHERAGHKADEIHEVPLSA