Sequence (fasta): 4mo7Download

>4MO7A:Transcriptional regulator I2
GPLGSMDEHKALGVMRTMVDSGQLTDPESARGKLLQTAAHLFRNKGFERTTVRDLASAVG
IQSGSIFHHFKSKDEILRAVMEETIHYNTAMMRASLEEASTVRERVLALIRCELQSIMGG
SGEAMAVLVYEWRSLSAEGQAHVLALRDVYEQIWLQVLGEAKAAGYIRGDVFITRRFLTG
ALSWTTTWFRAQGSLTLEELAEEALLMVLKSD