Sequence (fasta): 4h10Download

>4H10A:Aryl hydrocarbon receptor nuclear translocator-like protein 1
MHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKT
LRGAWLEHHHHHH
>4H10B:Circadian locomoter output cycles protein kaput
MDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEI
TAWLEHHHHHH
>4H10C:E-box DNA sense strand
AGGAACACGTGACCC
>4H10D:E-box DNA antisense strand
TGGGTCACGTGTTCC