Sequence (fasta): 4gstDownload

>4GSTA:GLUTATHIONE S-TRANSFERASE
PMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLP
YLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFE
KQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNL
KDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
>4GSTB:GLUTATHIONE S-TRANSFERASE
PMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLP
YLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFE
KQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNL
KDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK