Sequence (fasta): 4gbkDownload

>4GBKA:Insulin A chain
GIVEQCCTSICSLYQLENYCN
>4GBKC:Insulin A chain
GIVEQCCTSICSLYQLENYCN
>4GBKB:Insulin B chain
FVNQHLCGSHLVEALYLVCGERGFFYTDKT
>4GBKD:Insulin B chain
FVNQHLCGSHLVEALYLVCGERGFFYTDKT