Sequence (fasta): 4g5rDownload

>4G5RA:Guanine nucleotide-binding protein G(k) subunit alpha
EDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAI
IRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSR
EYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQ
RSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSI
ILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFT
CATDTKNVQFVFDAVTDVIIKNNLKECGLY
>4G5RB:Guanine nucleotide-binding protein G(k) subunit alpha
EDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAI
IRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSR
EYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQ
RSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSI
ILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFT
CATDTKNVQFVFDAVTDVIIKNNLKECGLY
>4G5RC:Guanine nucleotide-binding protein G(k) subunit alpha
EDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAI
IRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSR
EYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQ
RSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSI
ILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFT
CATDTKNVQFVFDAVTDVIIKNNLKECGLY
>4G5RD:Guanine nucleotide-binding protein G(k) subunit alpha
EDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAI
IRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSR
EYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQ
RSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSI
ILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFT
CATDTKNVQFVFDAVTDVIIKNNLKECGLY
>4G5RE:G-protein-signaling modulator 2
DEDFFSLILRSQAKRMDEQRVLLQR
>4G5RF:G-protein-signaling modulator 2
DEDFFSLILRSQAKRMDEQRVLLQR
>4G5RG:G-protein-signaling modulator 2
DEDFFSLILRSQAKRMDEQRVLLQR
>4G5RZ:G-protein-signaling modulator 2
DEDFFSLILRSQAKRMDEQRVLLQR