Sequence (fasta): 4f4vDownload

>4F4VA:Insulin A chain
GIVEQCCTSICSLYQLENYCN
>4F4VC:Insulin A chain
GIVEQCCTSICSLYQLENYCN
>4F4VB:Insulin B chain
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>4F4VD:Insulin B chain
FVNQHLCGSHLVEALYLVCGERGFFYTPKT